PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN00329.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 282aa    MW: 32318.9 Da    PI: 4.8354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN00329.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-173380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  l+++v+  G g+W++ ar  g++Rt+k+c++rw++yl
       KHN00329.1 33 KGPWTEEEDSVLINYVNFQGEGQWNSLARSAGLKRTGKSCRLRWLNYL 80
                     79********************************************97 PP

2Myb_DNA-binding47.34.7e-1586129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l+++++ ++G++ W++Ia+++g gRt++++k++w++
       KHN00329.1  86 RGNITLQEQLLILELHSRWGNR-WAKIAEELG-GRTDNEIKNYWRT 129
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS51294162880IPR017930Myb domain
SuperFamilySSF466893.4E-2930127IPR009057Homeodomain-like
SMARTSM007177.1E-143282IPR001005SANT/Myb domain
PfamPF002494.2E-153380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-213487IPR009057Homeodomain-like
CDDcd001671.85E-93580No hitNo description
PROSITE profilePS5129422.43881135IPR017930Myb domain
SMARTSM007173.0E-1385133IPR001005SANT/Myb domain
PfamPF002494.8E-1486129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2088133IPR009057Homeodomain-like
CDDcd001672.62E-6106129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDTISVQAMR SLSDSDSLSS ATYASEEDMK IKKGPWTEEE DSVLINYVNF QGEGQWNSLA  60
RSAGLKRTGK SCRLRWLNYL RPNVRRGNIT LQEQLLILEL HSRWGNRWAK IAEELGGRTD  120
NEIKNYWRTR VVKQAKQLKC DVNSKQFRDT VRFVWMPRLM EQIQASFRIV PSDSSHGLDQ  180
TTLCNTQQTE SSTDANPTMF CDNSMVSSYS SEVDLQPLSL SDTSTTSSSE SAEKKESISS  240
SLWQQWDYSD LQAFEPCNGF GDADLWTDEN IWFLQQHLAD HL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-233112725120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5892991e-124KC589299.1 Macrotyloma uniflorum cultivar VZM-1 transcription factor MYB76 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536860.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A0B2NYJ00.0A0A0B2NYJ0_GLYSO; Myb-related protein 305
TrEMBLI1L7M40.0I1L7M4_SOYBN; Uncharacterized protein
STRINGGLYMA10G01340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87534125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-68myb domain protein 78
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]